PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG642600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family GRAS
Protein Properties Length: 537aa    MW: 59599 Da    PI: 6.5041
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG642600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS4163.4e-1271655351373
                 GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPi 90 
                          l++l+++c +av++ ++   +al+++l++++s +g+pmqRl ay++e+L arl+++++ lyk+l+++e    +sse +++++l+++++P+
  Pavir.9KG642600.1.p 165 LRQLIIACGKAVDE-NACYMDALMSELRQMVSVSGEPMQRLGAYMLEGLIARLSSTGHALYKSLKCKEPV-ATSSELMSYMHLLYDICPF 252
                          6899********98.88999************************************************97.789999************* PP

                 GRAS  91 lkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfef 178
                          +kf+++ aN aI +av+ge+ +HiiDf+i qG QW++++qaLasRp+  p lRiTg+++++s   +   l  +g+rL+++A+++g+pfef
  Pavir.9KG642600.1.p 253 FKFGYMSANGAIADAVKGENFIHIIDFQIAQGSQWMTMIQALASRPGRRPYLRITGIDDSNSAhaRGGGLDIVGQRLHSVAQSCGLPFEF 342
                          ***********************************************************8888889999********************* PP

                 GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalf 268
                          n+ v  + +++ +e+L +++gEa++Vn+++qlh+++desv +e++rd++L++vkslsP+vv++veqea++n+++F+ r le+l+yy+a+f
  Pavir.9KG642600.1.p 343 NP-VPAASHEVMYEHLCIRHGEAIVVNFAYQLHHTPDESVGVENHRDRILRMVKSLSPRVVTLVEQEANTNTAPFFLRYLETLDYYTAMF 431
                          **.79999999******************************************************************************* PP

                 GRAS 269 dsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgsl 358
                          +++++  pr++++ri+ E+++++r+ivn++acegaer+erhe ++kWr+rl +aGF+p+pls  +++++k+ll  ++s  yr+ee++g l
  Pavir.9KG642600.1.p 432 EAIDVARPRDDKKRISAEQHCVARDIVNLIACEGAERIERHEPFGKWRARLAMAGFRPYPLSPVVNSTIKTLLDSYHSY-YRLEEKDGVL 520
                          *****************************************************************************66.********** PP

                 GRAS 359 vlgWkdrpLvsvSaW 373
                          +lgWk+r+Lv+ SaW
  Pavir.9KG642600.1.p 521 YLGWKNRKLVVSSAW 535
                          *************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.243139517IPR005202Transcription factor GRAS
PfamPF035141.2E-124165535IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 537 aa     Download sequence    Send to blast
MSTQASNRSY RYPDNTQIPY YNGNLVPVGG NGTYYMPQNH DDGHYISSDD GSQNTNSRAQ  60
GFQAQYCTLD SSSANCVYPA HNSTSSQSQS GSPLSQQESH SDHAYGSSPS ASCVTQVPSW  120
TLKDLENVML GPDSDIGSPD SSLLSGTALH ENNWRELLGI KTGDLRQLII ACGKAVDENA  180
CYMDALMSEL RQMVSVSGEP MQRLGAYMLE GLIARLSSTG HALYKSLKCK EPVATSSELM  240
SYMHLLYDIC PFFKFGYMSA NGAIADAVKG ENFIHIIDFQ IAQGSQWMTM IQALASRPGR  300
RPYLRITGID DSNSAHARGG GLDIVGQRLH SVAQSCGLPF EFNPVPAASH EVMYEHLCIR  360
HGEAIVVNFA YQLHHTPDES VGVENHRDRI LRMVKSLSPR VVTLVEQEAN TNTAPFFLRY  420
LETLDYYTAM FEAIDVARPR DDKKRISAEQ HCVARDIVNL IACEGAERIE RHEPFGKWRA  480
RLAMAGFRPY PLSPVVNSTI KTLLDSYHSY YRLEEKDGVL YLGWKNRKLV VSSAWC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-601675356374GRAS family transcription factor containing p
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.57210.0callus| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0672840.0BT067284.1 Zea mays full-length cDNA clone ZM_BFb0379I09 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985375.10.0PREDICTED: scarecrow-like protein 21
SwissprotQ8GVE10.0CIGR2_ORYSJ; Chitin-inducible gibberellin-responsive protein 2
TrEMBLK4A8830.0K4A883_SETIT; Uncharacterized protein
STRINGSi035089m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP151337117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein